PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA47G00003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 239aa    MW: 27686.4 Da    PI: 10.2041
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA47G00003genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-1695140147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v  +G+ +W++Ia++++ gR++k+c++rw++ 
       AA47G00003  95 RGHWRPAEDAKLKELVSIYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 140
                      899*****************************.***********996 PP

2Myb_DNA-binding58.41.6e-18147190146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ 
       AA47G00003 147 RRAFSEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 190
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.89590141IPR017930Myb domain
SuperFamilySSF466894.3E-2993188IPR009057Homeodomain-like
SMARTSM007173.2E-1494143IPR001005SANT/Myb domain
PfamPF002493.6E-1695140IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2696148IPR009057Homeodomain-like
CDDcd001678.12E-1398139No hitNo description
PROSITE profilePS5129426.669142196IPR017930Myb domain
SMARTSM007178.4E-15146194IPR001005SANT/Myb domain
PfamPF002491.8E-15147189IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-21149195IPR009057Homeodomain-like
CDDcd001671.33E-11149189No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGLVYADVAS LSITPPFPFP SSSWDYFPLN IKNYTEQEHQ HITNPKITTN QARFFFEDGI  60
DNFRTDTGTK KEATESRSCT QSSSSSSSSK ISVARGHWRP AEDAKLKELV SIYGPQNWNL  120
IAEKLQGRSG KSCRLRWFNQ LDPRINRRAF SEEEEERLMQ AHRLYGNKWA MIARLFPGRT  180
DNSVKNHWHV IMARKFRQQS NAYRRKNMMM LPLDQTQLFI PIPCLQGLLS SPLSTLNFH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-34921964108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391000.11e-89hypothetical protein EUTSA_v10019759mg
TrEMBLV4MAR51e-89V4MAR5_EUTSA; Uncharacterized protein
STRINGAT1G69560.11e-87(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.15e-81myb domain protein 105